Use Klarna anywhere, on your computer.

Shop, pay and track faster in the app.

Sign up to receive the latest news by email about Klarna’s services and promotions as well as Klarna’s partner deals & offers. Unsubscribe any time.

Explore our search engine and how we rank items.

Why are you seeing this?

Office Stationery

Arc Menuboards feature a stylish, curved design that blends beautifully with the modern environment.The magnetic poster cover enables displays to be quickly changedand the adjustable header allows for portrait or landscape presentation.It is equipped

SECO Arc Menu Board Holder Steel Base A4 Black - ARCA4-B 24940SS

OnBuy

Magnetic Dry Erase Menu Board for Fridge Includes 4 Liquid Chalk Markers - Weekly Meal Planner Blackboard, Grocery List and Notepad for Kitchen...

Magnetic Dry Erase Menu Board for Fridge Includes 4 Liquid Chalk Markers Weekly Meal Planner Blackboard Grocery List and Notepad for Kitchen

SECO Arc Menu Board Holder Steel Base A4 Silver - ARCA4-S 24933SS

MoKo Magnetic Menu Board for Kitchen Fridge with 8 Color Chalk Markers, 16"x12" Dry Erase Weekly Meal Planner and Grocery Shopping List...

Magnetic Menu Board for Kitchen Fridge with 8 Color Chalk Markers, 16"x12" Dry Erase Weekly Meal Planner and Grocery Shopping List Notepad Chalkboard

Material:resinSize:43*33cmPackageincludes:1pc

(as the picture) A3 Fridge Calendar Sheet Magnetic Sticker Message Board Menu Dry Erase Monthly Planner For Refrigerator Whiteboard

Largemagneticwhiteboardcanreminderrecordfamilyweeklyplannerthedailylifechoresandshorttermplanning,

Whiteboard Magnetic Fridge White Board A3+ for Home Kitchen Menu Meal Shopping List, Reminder Notice Memo Mark Board Daily Weekly Planner,Graffiti Dry

eBay

100cm Wood A-Frame Blackboard Chalkboard Cafe Bar Pub Promotion Menu Sign Board

Magnetic Fridge Menu Board 16"x12" Chalkboard Planner w/ 8 Markers Weekly

Acrylic Magnetic Menu Planner Board for Fridge-  Dry Erase 40 x 30cm

PREMIUM BLACKBOARD MAGNETIC WOODEN FRAMED OFFICE NOTICE MENU CHALK BOARD

Magnetic Menu Board For Kitchen Fridge With 8 Color Chalk Markers 16 x12 Dry Er

Magnetic Menu Board with 6 Color Pens Clear Planner Board for Refrigerator -M6

MoKo Magnetic Menu Board for Kitchen Fridge with 8 Color Chalk Markers, 16"x12"

Large A-Frame Chalkboard LED Magnetic Menu Board DIY Blackboard for Party, Shop

Wipe Magnetic Whiteboard Menu Writing Teaching White Board Kitchen Chalkboard

Magnetic Dry Erase Menu Board - 16x12", Flowers - Weekly Meal Planner Whiteboar

Acrylic Meal Planner Magnetic Menu Board for Kitchen Fridge with 6 Magnetic Mar

A2 LED Illuminated Backlit Slim Poster Display Menu Board | Magnetic Frame 

A3 Magnetic Whiteboard Planner, Weekly White Board Calendar, Menu Plan Shop list

Chalkboard Blackboard Wooden Frame Office Notice Menu Sign Score Board Graded

Zoro UK

This modern, multifunctional Artverum magnetic glass board is the striking way to present food and drinks, menus or special offers in any restaurant or catering outlet.  The matt magnetic glass board from the international award-winning Artverum range in the 90 x 120 cm format, Happy Hour design (motif: menu board) in black, white, is bound to impress with its high colour brilliance, sharpness of detail and practically non-reflective surface, even in difficult lighting conditions. It is simple to mount with the enclosed mounting materials and can be combined with other boards with the same wall clearance of 15 mm.

Artverum Magnetic GLS Board 900x1200

E.M.P.

Magic: The Gathering - Hammer Of Bogardan - Official Licensed T-Shirt - red - cotton - S, M, L, XXL - Length: regular length Fit: Regular Neckline: Round neck Front and back printed Logo label at the side Raglan sleeves Mineral Wash

Magic: The Gathering  T-Shirt - Hammer Of Bogardan - for Men - red

Official merchandise available at EMPSlipkt Blurry T-Shirt available in sizes S, M, L, XL, XXL, 3XL.Details:Colour: dark redPattern: plainMain material: 100% cottonFit: RegularSleeve length: Short sleevesCut: Round neckCollar style: Collarless

Slipknot Blurry T-Shirt dark red

Goldsmiths

From our By Request collection, this 9ct White Gold Square Cut Emerald Ring is set in a 4 claw White Gold Setting. Centre Stone: 5x5mm. Matching pendant and earrings are available to complete the look. By Request product is ordered direct from our supplier and is bespoke made to each order. Emerald Disclaimer: The colour is representative of the stones available and the finished piece may vary in shade to the image shown.

9ct White Gold 4 Claw Square Emerald 5mm x 5mm Ring- Ring Size N.5

Hoka

Cette paire de chaussettes est à votre image : modeste, elle sait rester discrète et remplit sa mission au quotidien. Conçue pour offrir un confort absolu, elle est l’accessoire essentiel de tout athlète. Pourquoi vous allez l’adorer: Son design minimaliste et sa matière confortable la rendent indispensable. | HOKA Chaussettes de running invisibles en Diva Blue/Citrus Taille S

HOKA Chaussettes de running invisibles en Diva Blue/Citrus Taille S

Myprotein

Enhance your workout wardrobe with the MP Men's Tempo Binding Vest. Engineered for peak performance, this vest is designed to keep you at your best no matter the workout. Its sweat-wicking technology ensures you stay cool and dry, allowing you to focus entirely on your goals without distraction.  For added comfort, the vest features laser-cut holes that provide superior ventilation and breathability, ensuring optimum airflow throughout your workout. Binding details add a touch of style whilst ensuring a comfortable fit that moves with you.  The Tempo Binding Vest is treated with an antimicrobial finish, incorporating silver chloride to maintain freshness wear after wear. This feature ensures your gear stays fresher for longer, making it a reliable choice for consistent performance. Elevate your training experience with the MP Men's Tempo Binding Vest.

MP Men's Tempo Binding Vest - Rock - XXXL

NA-KD

This long sleeve top features structured, stretchy lace material. It has a relaxed relaxed fit and a high neckline. The long sleeve top has seam details.

magnetic menu board