Use Klarna anywhere, on your computer.

Shop, pay and track faster in the app.

Sign up to receive the latest news by email about Klarna’s services and promotions as well as Klarna’s partner deals & offers. Unsubscribe any time.

Explore our search engine and how we rank items.

Why are you seeing this?

OnBuy

LSA International GI16 Gio Tumbler (low) 310ml Clear x 4

ModernandlightweightLSAInternational'sstackableGiotumblerhasfineglasswallswhichmakeitpracticalforeverydaydiningandentertainingalike.

LSA International GI18 Gio Tumbler (large) 560ml Clear x 4

eBay

LSA Gio Line Tumbler 310ml Set Of 4 BNIB

LSA International Gio Tumbler (large) 560 ml Clear | Set of 4 | 560ml 

LSA International Gio Tumbler 560ml Clear Set of 4 Candle Holder Tumbler New

LSA Arc Tumbler 260ml, Clear, Set of 4, Stackable, BNIB

NEW - LSA Arc Contrast Tumblers 380ml - Set of 4 - Multiple Colors Available

LSA International Metallic Polka Tumbler Set 14.1oz Pack of 4, Stylish Drinkware

LSA International Arc Tumbler (Large) 550 Ml Clear | Set of 4 | 550ml

LSA International Arc Stackable Glass Tumblers 260Ml New Boxed Simplistic

LSA International Borough Tumblers, Set of 4, 300ml, Clear

Selfridges

Lsa Gio Tumbler 390ml

LSA International

LSA Gio Tumbler - clear - 220ml

LSA Gio Tumbler (Low) - clear - 310ml

LSA Gio Tumbler (Small) - clear - 390ml

Perigord Champagne Flute – Box of 6 These glasses are made in France by La Rochère. The glasses are mould made, so there is a feint line where the two parts of the glass are joined. The Perigord design has a knopped stem and a faceted bowl; it is a classically elegant design that would look effortlessly stylish on any table. This is the largest size wine glass from the range and has a capacity of 16cl. Alongside this design we also stock a tall glass, a short tumbler and two sizes of wine glass. All of them work well alongside one another or would look great with a plain straight sided glass such as the Gio range by LSA. This listing is for a box of 6 glasses. La Rochère is the oldest glassworks in France and has been producing glass since 1475. Dishwasher safe. Measurements (each glass): Height: 17cm Diameter: 7cm

Perigord Champagne Flute Box of 6 by La Rochere

Perigord Large Wine Glass – Box of 6 These glasses are made in France by La Rochère. The glasses are mould made, so there is a feint line where the two parts of the glass are joined. The Perigord design has a knopped stem and a faceted bowl; it is a classically elegant design that would look effortlessly stylish on any table. This is the largest size wine glass from the range and has a capacity of 22cl. Alongside this design we also have a smaller wine glass (for white wine, although we’re not prescriptive in these matters!), a tall glass, a short tumbler and a champagne flute. All of them work well alongside one another or would look great with a plain straight sided glass such as the Gio range by LSA. This listing is for a box of 6 individual glasses. La Rochère is the oldest glassworks in France and has been producing glass since 1475. Dishwasher safe. Measurements (each glass) Height: 15cm Diameter: 8cm

Perigord Large Wine Glass Box of 6 by La Rochere

Perigord Wine Glass - Box of 6 These glasses are made in France by La Rochère. The glasses are mould made, so there is a feint line where the two parts of the glass are joined. The Perigord design has a knopped stem and a faceted bowl; it is a classically elegant design that would look effortlessly stylish on any table. This is the standard size wine glass from the range and has a capacity of 19cl. Alongside this design we also have a larger wine glass (for red wine, although we’re not prescriptive in these matters!), a tall glass, a short tumbler and a champagne flute. All of them work well alongside one another or would look great with a plain straight sided glass such as the Gio range by LSA. This listing is for a box of 6 glasses. La Rochère is the oldest glassworks in France and has been producing glass since 1475. Dishwasher safe. Measurements (each glass) Height: 14cm Diameter: 8cm

Perigord Wine Glass Box of 6 by La Rochere

Burton

Introducing Our Essential Skinny Fit Smart Trousers, A Must-Have Addition To Your Wardrobe. This Trousers Features A Zip Fly Fastening For Convenience And Is Designed To Provide A Sleek And Polished Look. Made With A Polyester Viscose Blend With Added Stretch Ensures A Cool And Comfortable Fit All Day Long. Pair This Versatile Trousers With Matching Items, Perfect For Any Smart Occasion.

Mens Black Tailored Fit Essential Suit Jacket

E.M.P.

Ghost - Meliora - Official Licensed Girls Top - black - cotton - M, L, XL, XXL - Ghost - Meliora - large front print - round neck top - regular fit

Ghost  Top - Meliora - for Women - black

Art Nation available at EMP- Art Nation The ascendance CD

Art Nation CD - The ascendance Standard

Goldsmiths

From the Goldsmiths Wedding Ring Collection, This 5mm D Shape Heavy polished chamfered edges with matt centre Wedding Ring in Platinum The ring is available in 9 or 18 carat white gold, yellow gold and rose gold, platinum, 950 palladium with a range of band widths.

5mm D Shape Heavy Polished Chamfered Edges With Matt Centre Wedding Ring In Platinum - Ring Size Y

Hoka

Adhérence et dynamisme sur les terrains techniques. Vous cherchiez le summum de la chaussure de trail. Et vous lavez trouvé. Fusion de lamorti éprouvé de HOKA, dune adhérence incisive et de matières ultralégères, la Speedgoat 6 est née pour dompter le trail. Fiable et résistante, cette réédition récente a été affinée grâce à une tige en textile tissé respirant, une structure interne qui enveloppe le pied, une languette à double soufflet plus moelleuse et des crampons réorientés en sinspirant du sabot dun chamois (évidemment). | HOKA Speedgoat 6 Chaussures pour Homme en White/Neon Tangerine Taille 44 2/3 | Trail

HOKA Speedgoat 6 Chaussures pour Homme en White/Neon Tangerine Taille 44 2/3 | Trail

Myprotein

Juicy by nature, powerful by design. Clear Whey Protein is fruity, refreshing, and completely loaded with proteinyou'll be obsessed with every thirst-quenching sip.  With 20g of protein in every serving*, it supports muscle growth, maintenance, and recovery.1 So you can get the most from your workouts, stay consistent, and bounce back.1  Now, you can pick two 20 serving tubs from a vibrant selection of flavours, including Raspberry Lemonade, Peach Tea, Cranberry & Raspberry, Orange Mango, Watermelon, Tropical Dragon Fruit, Pineapple, and Strawberry Kiwi. Lighter than traditional creamy whey and packing more punch than your average juice, Clear Whey is the juicy way to smash your protein goal. Performance Advisory Board  Bringing together world-class scientists, doctors, and athletes to shape innovation at Myproteincombining cutting-edge research with real-world testing to create solutions that actually deliver, for everybody. Find out more about our Performance Advisory Board.

Clear Whey Protein Powder – Twin Pack - Strawberry Kiwi - Strawberry Kiwi

NA-KD

This cardigan is knitted and features a big collar and a stretchy material. It has ribbed hems and a button closure.

lsa gio tumbler